PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07354A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 353aa    MW: 37968.3 Da    PI: 9.1467
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07354AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14e-13101145347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT+eE+  ++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
  Oropetium_20150105_07354A 101 PWTEEEHRMFLMGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 145
                                8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.565319IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.02494150IPR017930Myb domain
SuperFamilySSF466898.97E-1796150IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-1997149IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.6E-1298144IPR009057Homeodomain-like
SMARTSM007172.6E-1198148IPR001005SANT/Myb domain
CDDcd001674.44E-9101146No hitNo description
PfamPF002491.1E-10101145IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNARTCPA RSGGGGGGVR LFGVHLTSAP APAMMKKSAS MSCIASSLGD  60
GSGGSSPPAG GRGGGDGYVS DDPAHASCSA NGRAERKKGT PWTEEEHRMF LMGLQKLGKG  120
DWRGISRNFV VSRTPTQVAS HAQKYFIRQT NSSRRKRRSS LFDMVPEMPM DESPAAVEPS  180
HQNNPDETTS SNHLPSLHVG LQKEAEFAKQ LSRQHEESEF AEPSLPLVDL EMNSCIPFKT  240
ITESTVPAFC PALVPVPXXX XXXXXXXXXX XXXXXXXXXX XXXRGKEAVK ADNVIGMSKL  300
SIGETSSGSM EPTTLSLQLI GSMEARQSAF HVSPPRTRPD LSKRNSSPIH AV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149973.11e-166myb-related transcription activator
TrEMBLB4FMD21e-166B4FMD2_MAIZE; MYB-RELATED transcription factor
TrEMBLK7UNL81e-165K7UNL8_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGSb03g003270.11e-161(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19393791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-61MYB_related family protein